| Desktop | 20/100 | ✘ |
| Mobile | 4/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 169 KB | ✔ |
| Compression | 32 KB (-81%) | ✔ |
| Text/Html Ratio | 19280 / 173292 (bytes) = 11.13% | ✔ |
| Load Time | 2.64 second | ✘ |
| Mobile Ready | 99/100 | ✔ |
| In-Page Links | 90 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 27 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | Yes | ✘ |
| Iframe | Yes | ✘ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | Yes | ✔ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| cleaning | 92 | ✔ | ✔ | ✔ |
| clean | 49 | ✔ | ✔ | ✔ |
| home | 48 | ✘ | ✔ | ✔ |
| service | 36 | ✔ | ✔ | ✔ |
| maid | 28 | ✔ | ✔ | ✔ |
| services | 26 | ✔ | ✔ | ✔ |
| time | 24 | ✘ | ✘ | ✘ |
| sparkly | 23 | ✔ | ✔ | ✔ |
| house | 21 | ✘ | ✔ | ✔ |
| have | 17 | ✘ | ✘ | ✘ |
| they | 17 | ✘ | ✘ | ✘ |
| like | 16 | ✘ | ✘ | ✘ |
| would | 16 | ✘ | ✘ | ✔ |
| chicago | 14 | ✔ | ✔ | ✔ |
| cleaners | 14 | ✘ | ✔ | ✘ |
|
With 2.64 seconds in page load, 169 KB of page size and all other reports below, the sparklymaidcleaningservices.com has a SEO score of 63 out of 100 |
| Title | #1 Cleaning Services Chicago | 5-Star Maid Service | Sparkly Maid |
| Description | Professional Chicago Cleaning Services ✅ Google Guaranteed ✅ 5-Star Maid Service ✅ Call ☎ (224) 214-0145 Only $90. Sparkly Maid Cleans Your Home Or Apartment Today. House Cleaning Services, Maid Services, House Cleaning, Maid Cleaning Service, Housekeepers, House Cleaners, Green Cleaning, Home Cleaning, Condo Cleaning, Deep Cleaning, Move Out Cleaning, Move In Cleaning, Post Construction Cleaning |
| Keyword |
| Age | 0 Years, 3 Days |
| Created | 4th-May-2020 |
| Updated | 4th-May-2020 |
| Expiry | 4th-May-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
|
Domain Name: SPARKLYMAIDCLEANINGSERVICES.COM Registry Domain ID: 2521942786_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.tucows.com Registrar URL: http://tucowsdomains.com Updated Date: 2020-05-04T09:24:02 Creation Date: 2020-05-04T09:23:58 Registrar Registration Expiration Date: 2021-05-04T09:23:58 Registrar: TUCOWS, INC. Registrar IANA ID: 69 Reseller: Squarespace Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Registry Registrant ID: Registrant Name: Contact Privacy Inc. Customer 0157805057 Registrant Organization: Contact Privacy Inc. Customer 0157805057 Registrant Street: 96 Mowat Ave Registrant City: Toronto Registrant State/Province: ON Registrant Postal Code: M6K 3M1 Registrant Country: CA Registrant Phone: +1.4165385457 Registrant Phone Ext: Registrant Fax: Registrant Fax Ext: Registrant Email: sparklymaidcleaningservices.com@contactprivacy.com Registry Admin ID: Admin Name: Contact Privacy Inc. Customer 0157805057 Admin Organization: Contact Privacy Inc. Customer 0157805057 Admin Street: 96 Mowat Ave Admin City: Toronto Admin State/Province: ON Admin Postal Code: M6K 3M1 Admin Country: CA Admin Phone: +1.4165385457 Admin Phone Ext: Admin Fax: Admin Fax Ext: Admin Email: sparklymaidcleaningservices.com@contactprivacy.com Registry Tech ID: Tech Name: Contact Privacy Inc. Customer 0157805057 Tech Organization: Contact Privacy Inc. Customer 0157805057 Tech Street: 96 Mowat Ave Tech City: Toronto Tech State/Province: ON Tech Postal Code: M6K 3M1 Tech Country: CA Tech Phone: +1.4165385457 Tech Phone Ext: Tech Fax: Tech Fax Ext: Tech Email: sparklymaidcleaningservices.com@contactprivacy.com Name Server: dns1.p01.nsone.net Name Server: dns2.p01.nsone.net Name Server: dns3.p01.nsone.net Name Server: dns4.p01.nsone.net Name Server: ns01.squarespacedns.com Name Server: ns02.squarespacedns.com Name Server: ns03.squarespacedns.com Name Server: ns04.squarespacedns.com DNSSEC: unsigned Registrar Abuse Contact Email: domainabuse@tucows.com Registrar Abuse Contact Phone: +1.4165350123 URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-05-07T13:08:18Z |
| Server IP | 198.49.23.144 |
| Server Location | United States |
| Service Provider | Squarespace |
| Domains (TLD) | Status |
|---|---|
| sparklymaidcleaningservices.net | Available |
| sparklymaidcleaningservices.org | Available |
| sparklymaidcleaningservices.biz | Already Registered |
| sparklymaidcleaningservices.io | Already Registered |
| sparklymaidcleaningservices.info | Available |
| Domains (TLD) | Status |
|---|---|
| qparklymaidcleaningservices.com | Available |
| wparklymaidcleaningservices.com | Available |
| eparklymaidcleaningservices.com | Available |
| zparklymaidcleaningservices.com | Available |
| xparklymaidcleaningservices.com | Available |
| Rodrigosalazarsanchez.com |
| Onmylunch.com |
| Lyjscc.com |
| Nailsbyk8.com |
| Mortgagelender-coloradosprings.com |
| Homeinnature.com |
| Arsharpshooter.com |
| Saladstorysklep.com |
| Aldogrippaldi.com |
| Careavital.com |